PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00847.1.g00020.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 617aa    MW: 66340.7 Da    PI: 10.7104
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00847.1.g00020.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY29.11.9e-09426443219
                                     --SS-EEEEEEE--TT-S CS
                            WRKY   2 dDgynWrKYGqKevkgse 19 
                                     dDgynWrKYGqK+vkgs 
  Zpz_sc00847.1.g00020.1.am.mkhc 426 DDGYNWRKYGQKVVKGSA 443
                                     8***************96 PP

2WRKY105.72.4e-33512570159
                                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                     ldDgy+WrKYGqK+vkg+++prsYY+Ct+agC+v+k++er+++dpk+v++tYeg+H he
  Zpz_sc00847.1.g00020.1.am.mkhc 512 LDDGYRWRKYGQKVVKGNPHPRSYYKCTFAGCNVRKHIERASSDPKAVITTYEGKHSHE 570
                                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-7420443IPR003657WRKY domain
SuperFamilySSF1182902.22E-6423443IPR003657WRKY domain
PfamPF031061.4E-5426443IPR003657WRKY domain
PROSITE profilePS508119.557426442IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-36498572IPR003657WRKY domain
SuperFamilySSF1182901.03E-28504572IPR003657WRKY domain
PROSITE profilePS5081136.839507572IPR003657WRKY domain
SMARTSM007745.3E-39512571IPR003657WRKY domain
PfamPF031061.5E-25513569IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 617 aa     Download sequence    Send to blast
DKRSHRSRPR RCYSTSPCRR ISTPPIGLGT LAPPLKPSCH VKQVEPQRLG ATALPQHPSS  60
TSLGATALHL FAPATECFSD LGLPLCSTQS RIRITGSSPA PPLHSLRGIL LQVSVPGSAA  120
RKKKSFSRRN VLLLRSRPPE AATSAARRRR DASFIHEEEN RLSLSLGSAA PATMSARPPP  180
PPRPRLALPP RSNSESLFTG AGDASPGPLT LASALFSSDT GGGTSSSTGT GATSFTELLI  240
GSLAPPPPSL APQQQQQQHE AERGRGGVAR AGPALSVAPP ASSASAASVF TVPPGLSPSG  300
LFDSPGLLFS PAMSRNQLFL QIFTTIRCWL ISSPRSPSAS LDPRAAGPDL RRLCVLPVLD  360
LIPVGSVVRA RRRPRRLRRG IWNVASAGSG SSYSPSKPFS SENSAEASQR YQVNAPVNAV  420
VDKPADDGYN WRKYGQKVVK GSAKRDPEAM YGMSEQLSGL SEGDDMEDGE SRPQEVDDGD  480
NENKRRTLQI SSQRTLSEPK IIVQTTSEVD LLDDGYRWRK YGQKVVKGNP HPRSYYKCTF  540
AGCNVRKHIE RASSDPKAVI TTYEGKHSHE PPVGRGSNQN AGMSQQKGQN NQASLSRTDF  600
SNANQMQMGF LQFKREE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-37503572877Probable WRKY transcription factor 4
2lex_A1e-37503572877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0341961e-148BT034196.1 Zea mays full-length cDNA clone ZM_BFc0028G06 mRNA, complete cds.
GenBankBT0538111e-148BT053811.1 Zea mays full-length cDNA clone ZM_BFb0199A02 mRNA, complete cds.
GenBankBT0548221e-148BT054822.1 Zea mays full-length cDNA clone ZM_BFb0078G18 mRNA, complete cds.
GenBankKJ7285321e-148KJ728532.1 Zea mays clone pUT6837 WRKY transcription factor (WRKY62) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147897.11e-113uncharacterized protein LOC100281507
TrEMBLB6SYC51e-143B6SYC5_MAIZE; SPF1-like DNA-binding protein
STRINGGRMZM2G076657_P011e-143(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.13e-48WRKY DNA-binding protein 3